PTM Viewer PTM Viewer

AT5G13410.1

Arabidopsis thaliana [ath]

FKBP-like peptidyl-prolyl cis-trans isomerase family protein

No PTMs currently found

PLAZA: AT5G13410
Gene Family: HOM05D002468
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 256

MASISSFGCFPQSTALAGTSSTTRCRTTVAARLADQSDDFAPLRSSGGNCGCVNNSGEFDRRKLLVSSVGLLIGALSYDSKDGDFASASQFADMPALKGKDYGKTKMKYPDYTETQSGLQYKDLRVGTGPIAKKGDKVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKEFFKFTLGSNEVIPAFEEAVSGMALGGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKIVPN

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR001179 131 254
Molecule Processing
Show Type From To
Transit Peptide 1 29
Transit Peptide 30 88

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here